PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_57426g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 154aa    MW: 16942 Da    PI: 7.7881
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_57426g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.62.2e-3187144260
    ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                    ++vrY+eC+kNhAas+Gg+avDGC Efm s geegtaaa+kCaAC+CHR+FHRre e+e
  MA_57426g0010  87 NRVRYRECRKNHAASIGGYAVDGCAEFMGS-GEEGTAAAMKCAACNCHRSFHRREAENE 144
                    689**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.7E-2989141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2189151IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.0E-2690140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.25891140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009741Biological Processresponse to brassinosteroid
GO:0043392Biological Processnegative regulation of DNA binding
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048509Biological Processregulation of meristem development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MPITSGCSIF IGNSMGLERY TQVKDQATDE LRSVFLHLRS EVPATKSVQI QPQSITSVEK  60
MGPSHFVQQI KDDAPVTVRG GDTASTNRVR YRECRKNHAA SIGGYAVDGC AEFMGSGEEG  120
TAAAMKCAAC NCHRSFHRRE AENETLCEYH RIRG
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0842460.0EF084246.1 Picea sitchensis clone WS0272_D12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008792497.11e-32PREDICTED: mini zinc finger protein 1-like
TrEMBLA9NSF71e-110A9NSF7_PICSI; Putative uncharacterized protein
STRINGGSMUA_AchrUn_randomP14420_0011e-27(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.11e-28mini zinc finger 1